Aquaporin 1/AQP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84488

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aquaporin 1/AQP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aquaporin 1/AQP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in human kidney and liver tissues. Corresponding AQP1 RNA-seq data are presented for the same tissues.
Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in control (vector only transfected HEK293T lysate) and aQP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunocytochemistry/Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human lung shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human kidney shows moderate to strong positivity in apical membranes in cells in tubules.
Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human rectum shows moderate positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488]

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for Aquaporin 1/AQP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-84488 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aquaporin 1/AQP1

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)

Alternate Names

AQP1, CHIP28, CO

Gene Symbol

AQP1

Additional Aquaporin 1/AQP1 Products

Product Documents for Aquaporin 1/AQP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aquaporin 1/AQP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Citations for Aquaporin 1/AQP1 Antibody - BSA Free

Customer Reviews for Aquaporin 1/AQP1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Aquaporin 1/AQP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Aquaporin 1/AQP1 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: corneal stromal cells
    Species: Feline
    Verified Customer | Posted 05/11/2022
    AQP1 in Cat Cornea Tissue
    AQP1 used at 1:50 on a feline cornea tissue. AQP1 antibody was used on feline paraffin-embedded cornea tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C.
    Aquaporin 1/AQP1 Antibody - BSA Free NBP1-84488

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin 1/AQP1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.

    A:

    A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies