Aquaporin-5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39043

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aquaporin 5/AQP5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aquaporin-5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Analysis in human salivary gland and liver tissues. Corresponding AQP5 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043]

Immunocytochemistry/ Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043]

Immunocytochemistry/Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043] - Staining of human cell line SiHa shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human testis shows strong membranous positivity in subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human salivary gland shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043]

Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human pancreas shows strong positivity in apical membrane in exocrine glandular cells.

Applications for Aquaporin-5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aquaporin 5/AQP5

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Long Name

Aquaporin 5

Alternate Names

AQP-5, AQP5, PPKB

Gene Symbol

AQP5

UniProt

P55064 (Human)

Additional Aquaporin 5/AQP5 Products

Product Documents for Aquaporin-5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aquaporin-5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Citations for Aquaporin-5 Antibody - BSA Free

Customer Reviews for Aquaporin-5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin-5 Antibody - BSA Free and earn rewards!

Have you used Aquaporin-5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies