ARC/ARG3.1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-56929
![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0010.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Avian
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for ARC/ARG3.1 Antibody - BSA Free
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T![Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Immunohistochemistry-Paraffin-NBP1-56929-img0004.jpg "Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929]")
Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929]
Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0005.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]")
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0007.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]")
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0008.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]")
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]](https://resources.rndsystems.com/images/products/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0009.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]")
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929]
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/mlApplications for ARC/ARG3.1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
5 ug/ml
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ARC/ARG3.1
Alternate Names
activity-regulated cytoskeleton-associated protein, ARC/ARG3.1, KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog
Gene Symbol
ARC
UniProt
Additional ARC/ARG3.1 Products
Product Documents for ARC/ARG3.1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ARC/ARG3.1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ARC/ARG3.1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for ARC/ARG3.1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ARC/ARG3.1 Antibody - BSA Free and earn rewards!
Have you used ARC/ARG3.1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...