ARHGAP17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83870

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARHGAP17 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGAP17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ARHGAP17 Antibody [NBP1-83870]

Immunocytochemistry/ Immunofluorescence: ARHGAP17 Antibody [NBP1-83870]

Immunocytochemistry/Immunofluorescence: ARHGAP17 Antibody [NBP1-83870] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
ARHGAP17 Antibody

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] -

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] -Staining of human tonsil shows moderate cytoplasmic positivity in germinal and non-germinal center cells.
ARHGAP17 Antibody

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] -

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
ARHGAP17 Antibody

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] -

Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
ARHGAP17 Antibody - BSA Free Immunohistochemistry-Paraffin: ARHGAP17 Antibody - BSA Free [NBP1-83870]

Immunohistochemistry-Paraffin: ARHGAP17 Antibody - BSA Free [NBP1-83870]

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
ARHGAP17 Antibody - BSA Free Western Blot: ARHGAP17 Antibody - BSA Free [NBP1-83870]

Western Blot: ARHGAP17 Antibody - BSA Free [NBP1-83870]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))

Applications for ARHGAP17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP17

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM]

Alternate Names

DKFZp564A1363, FLJ10308, FLJ13219, FLJ37567, FLJ43368, MGC87805, MST110, MSTP038, MSTP066, MSTP110, NADRIN, neuron-associated developmentally regulated protein, PP367, PP4534, Rho GTPase activating protein 17, rho GTPase-activating protein 17, RhoGAP interacting with CIP4 homologs 1, RhoGAP interacting with CIP4 homologs protein 1, Rho-type GTPase-activating protein 17, RICH-1, RICH1B, RICH1MST066, WBP15

Entrez Gene IDs

55114 (Human)

Gene Symbol

ARHGAP17

UniProt

Q68EM7 (Human)

Additional ARHGAP17 Products

Product Documents for ARHGAP17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARHGAP17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP17 Antibody - BSA Free and earn rewards!

Have you used ARHGAP17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies