ARHGAP30 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15556

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 485-585 of human ARHGAP30 (NP_859071.2). PLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGAP30 Antibody - Azide and BSA Free

Western Blot: ARHGAP30 AntibodyAzide and BSA Free [NBP3-15556]

Western Blot: ARHGAP30 AntibodyAzide and BSA Free [NBP3-15556]

Western Blot: ARHGAP30 Antibody [NBP3-15556] - Western blot analysis of extracts of Mouse spleen, using ARHGAP30 Rabbit pAb (NBP3-15556) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
ARHGAP30 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ARHGAP30 Antibody - Azide and BSA Free [NBP3-15556] -

Immunocytochemistry/ Immunofluorescence: ARHGAP30 Antibody - Azide and BSA Free [NBP3-15556] - Immunofluorescence analysis of HeLa cells using ARHGAP30 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ARHGAP30 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ARHGAP30 Antibody - Azide and BSA Free [NBP3-15556] -

Immunocytochemistry/ Immunofluorescence: ARHGAP30 Antibody - Azide and BSA Free [NBP3-15556] - Immunofluorescence analysis of NIH/3T3 cells using ARHGAP30 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ARHGAP30 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARHGAP30

Alternate Names

Rho GTPase activating protein 30

Gene Symbol

ARHGAP30

Additional ARHGAP30 Products

Product Documents for ARHGAP30 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP30 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ARHGAP30 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP30 Antibody - Azide and BSA Free and earn rewards!

Have you used ARHGAP30 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...