ARHGAP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35825

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARHGAP4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ARHGAP4 (NP_001158213.1).

Sequence:
SPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARHGAP4 Antibody - BSA Free

ARHGAP4 Antibody

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] -

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ARHGAP4 Antibody

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] -

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ARHGAP4 Antibody

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] -

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ARHGAP4 Antibody

Immunocytochemistry/ Immunofluorescence: ARHGAP4 Antibody [NBP3-35825] -

Immunocytochemistry/ Immunofluorescence: ARHGAP4 Antibody [NBP3-35825] - Immunofluorescence analysis of L929 cells using ARHGAP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ARHGAP4 Antibody

Western Blot: ARHGAP4 Antibody [NBP3-35825] -

Western Blot: ARHGAP4 Antibody [NBP3-35825] - Western blot analysis of lysates from Jurkat cells, using ARHGAP4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for ARHGAP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARHGAP4

The ARHGAP4 gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-bindingproteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to theGolgi complex and can redi

Alternate Names

RGC1, Rho GTPase activating protein 4

Gene Symbol

ARHGAP4

Additional ARHGAP4 Products

Product Documents for ARHGAP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARHGAP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP4 Antibody - BSA Free and earn rewards!

Have you used ARHGAP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies