ARL3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88839
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat
Predicted:
Mouse (95%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ARL3 Antibody - BSA Free
Western Blot: ARL3 Antibody [NBP1-88839]
Western Blot: ARL3 Antibody [NBP1-88839] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).Western Blot: ARL3 Antibody - BSA Free [NBP1-88839] -
Arl3-Y90C is a fast cycling GTPase.(A) 1% input (I) and eluates (E) from GST-PDE delta pulldowns using AD-293 lysates expressing 3XFLAG-tagged Arl3 mutants immunoblotted with anti-FLAG antibodies. (B) Arl3-Y90C-FLAG or Arl3-D129N-FLAG lysates were incubated with 10 mM ethylenediaminetetraacetic acid (EDTA) and/or 10 mM GTP, spiked with Mg2+, and precipitated with GST-PDE delta. Westerns immunoblotted for Arl3 with eluates shown on top, and 1% inputs shown below. Arl3-FLAG and endogenous Arl3 bands labeled. (C) Representative retinal cross-sections from Arl3-Y90C-FLAG- or Arl3-D129N-expressing rod photoreceptors stained with anti-FLAG antibodies (green) and counterstained with Hoechst (blue). Scale bars, 5 um. Nuclear position of electroporated rods represented as described in Figure 1.Figure 2—source data 1.Raw western blot images.Raw western blot images.GTP loading of wild-type Arl3-FLAG.Arl3-FLAG lysates were incubated with 10 mM EDTA and/or 10 mM GTP, spiked with Mg2+, and precipitated with GST-PDE delta. Westerns immunoblotted for Arl3 with eluates shown on top, and 1% inputs shown below. Arl3-FLAG and endogenous Arl3 bands labeled.Unlike Arl3-Q71L, Arl3-D67V does not form a ternary complex with RP2 and PDE delta.1% input (I) and eluates (E) from GST-PDE delta pulldowns using AD-293 lysates expressing 3XFLAG-tagged Arl3 mutants immunoblotted with anti-RP2 antibodies. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36598133), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: ARL3 Antibody [NBP1-88839]
Staining of human cerebral cortex shows strong cytoplasmic and nucleolar positivity in neuronal cells.Applications for ARL3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ARL3
Alternate Names
ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3
Entrez Gene IDs
403 (Human)
Gene Symbol
ARL3
UniProt
Additional ARL3 Products
Product Documents for ARL3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ARL3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ARL3 Antibody - BSA Free
Customer Reviews for ARL3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ARL3 Antibody - BSA Free and earn rewards!
Have you used ARL3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...