ARL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88839

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Predicted:

Mouse (95%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARL3 Antibody - BSA Free

Western Blot: ARL3 Antibody [NBP1-88839]

Western Blot: ARL3 Antibody [NBP1-88839]

Western Blot: ARL3 Antibody [NBP1-88839] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
ARL3 Antibody - BSA Free

Western Blot: ARL3 Antibody - BSA Free [NBP1-88839] -

Arl3-Y90C is a fast cycling GTPase.(A) 1% input (I) and eluates (E) from GST-PDE delta pulldowns using AD-293 lysates expressing 3XFLAG-tagged Arl3 mutants immunoblotted with anti-FLAG antibodies. (B) Arl3-Y90C-FLAG or Arl3-D129N-FLAG lysates were incubated with 10 mM ethylenediaminetetraacetic acid (EDTA) and/or 10 mM GTP, spiked with Mg2+, and precipitated with GST-PDE delta. Westerns immunoblotted for Arl3 with eluates shown on top, and 1% inputs shown below. Arl3-FLAG and endogenous Arl3 bands labeled. (C) Representative retinal cross-sections from Arl3-Y90C-FLAG- or Arl3-D129N-expressing rod photoreceptors stained with anti-FLAG antibodies (green) and counterstained with Hoechst (blue). Scale bars, 5 um. Nuclear position of electroporated rods represented as described in Figure 1.Figure 2—source data 1.Raw western blot images.Raw western blot images.GTP loading of wild-type Arl3-FLAG.Arl3-FLAG lysates were incubated with 10 mM EDTA and/or 10 mM GTP, spiked with Mg2+, and precipitated with GST-PDE delta. Westerns immunoblotted for Arl3 with eluates shown on top, and 1% inputs shown below. Arl3-FLAG and endogenous Arl3 bands labeled.Unlike Arl3-Q71L, Arl3-D67V does not form a ternary complex with RP2 and PDE delta.1% input (I) and eluates (E) from GST-PDE delta pulldowns using AD-293 lysates expressing 3XFLAG-tagged Arl3 mutants immunoblotted with anti-RP2 antibodies. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36598133), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARL3 Antibody - BSA Free Immunohistochemistry-Paraffin: ARL3 Antibody [NBP1-88839]

Immunohistochemistry-Paraffin: ARL3 Antibody [NBP1-88839]

Staining of human cerebral cortex shows strong cytoplasmic and nucleolar positivity in neuronal cells.

Applications for ARL3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARL3

ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq]

Alternate Names

ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3

Entrez Gene IDs

403 (Human)

Gene Symbol

ARL3

UniProt

Additional ARL3 Products

Product Documents for ARL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARL3 Antibody - BSA Free

Customer Reviews for ARL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARL3 Antibody - BSA Free and earn rewards!

Have you used ARL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...