ARNTL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10507

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL2 (NP_064568). Peptide sequence PTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLST

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARNTL2 Antibody - BSA Free

Western Blot: ARNTL2 Antibody [NBP3-10507]

Western Blot: ARNTL2 Antibody [NBP3-10507]

Western Blot: ARNTL2 Antibody [NBP3-10507] - Western blot analysis using NBP3-10507 on Human MCF7 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ARNTL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARNTL2

ARNTL2, or Aryl hydrocarbon receptor nuclear translocator-like protein 2, contains multiple isoforms that are 71 kDa, 69 kDa, 67 kDa, 66 kDa, 65.5 kDa, 65 kDa, 64 kDa, 61 kDa, and 60 kDa, and is involved in the activation of E-box element transcription. The protein has been linked to a variety of diseases and disorders through current research, including hypoxia, alcoholism, bipolar disorder, neuronitis, lupus erythematosus, schizophrenia, schizoaffective disorder, anemia, mood disorder, and Fanconi's anemia. ARNTL2 is associated with circadian rhythm and the regulation of transcription, and interacts with CLOCK, EPAS1, UBC, SERPINE1, and NPAS2.

Alternate Names

Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, BHLHE6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2

Gene Symbol

ARNTL2

Additional ARNTL2 Products

Product Documents for ARNTL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARNTL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARNTL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARNTL2 Antibody - BSA Free and earn rewards!

Have you used ARNTL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...