Asialoglycoprotein Receptor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85579

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Asialoglycoprotein Receptor 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining in human liver and pancreas tissues using anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody NBP1-85579 (A) shows similar protein distribution across tissues to independent antibody NBP1-85578 (B).
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas using Anti-ASGR2 antibody NBP1-85579.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579]

Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver using Anti-ASGR2 antibody NBP1-85579.

Applications for Asialoglycoprotein Receptor 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASGR2

Asialoglycoprotein Receptor 2 is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of plasma glycoproteins in which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. It is expressed exclusively in hepatic parenchymal cells and calcium is required for ligand binding. Asialoglycoprotein Receptor 2 may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. Asialoglycoprotein Receptor 2 is involved in hepatitis B, hepatitis C, liver cirrhosis, hepatocellular carcinoma, nephropathy, leukemia, urethritis, autoimmune hepatitis, alcoholic liver cirrhosis, and jaundice.

Long Name

Asialoglycoprotein Receptor 2

Alternate Names

ASGPR2, CLEC4H2, HBXBP

Entrez Gene IDs

433 (Human)

Gene Symbol

ASGR2

UniProt

Additional ASGR2 Products

Product Documents for Asialoglycoprotein Receptor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Asialoglycoprotein Receptor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Asialoglycoprotein Receptor 2 Antibody - BSA Free

Customer Reviews for Asialoglycoprotein Receptor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Asialoglycoprotein Receptor 2 Antibody - BSA Free and earn rewards!

Have you used Asialoglycoprotein Receptor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...