Aspartate Aminotransferase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54778

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24611772).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Aspartate Aminotransferase Antibody - BSA Free

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Titration: 1.0ug/ml, Positive Control: NCI-H226 cell lysate.
Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Human Fetal Liver.
Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778]

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Human NCI-H226.

Applications for Aspartate Aminotransferase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in Immunohistochemistry reported in scientific literature (PMID 27623078). Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 29375049).

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aspartate Aminotransferase

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Glutamic-oxaloacetic transaminase 1

Alternate Names

aspartate aminotransferase, cytoplasmic, AST1, ASTQTL1, CASPAT, CCAT, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, EC 2.6.1.1, EC 2.6.1.3, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), GOT1, growth-inhibiting protein 18, SGOT, Transaminase A

Entrez Gene IDs

2805 (Human)

Gene Symbol

GOT1

UniProt

Additional Aspartate Aminotransferase Products

Product Documents for Aspartate Aminotransferase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aspartate Aminotransferase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Aspartate Aminotransferase Antibody - BSA Free

Customer Reviews for Aspartate Aminotransferase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aspartate Aminotransferase Antibody - BSA Free and earn rewards!

Have you used Aspartate Aminotransferase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...