Ataxin-10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14336

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ataxin-10 Antibody - BSA Free

Western Blot: Ataxin-10 Antibody [NBP2-14336]

Western Blot: Ataxin-10 Antibody [NBP2-14336]

Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ataxin-10 Antibody [NBP2-14336]

Immunocytochemistry/ Immunofluorescence: Ataxin-10 Antibody [NBP2-14336]

Immunocytochemistry/Immunofluorescence: Ataxin-10 Antibody [NBP2-14336] - Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336]

Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336]

Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Applications for Ataxin-10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ataxin-10

Pentanucleotide repeat expansions in the ATXN10/SCA10 gene have been linked to spinocerebellar ataxia type 10, a disorder that is characterized by gait ataxia, cognitive development, and seizures. ATXN10/SCA10 is an evolutionarily conserved protein whose function has not been identified. It is proposed that the repeats in ATXN10/SCA10 may form unusual RNA hairpin structures that result in toxic RNA that may have biological effects such as sequestering of proteins, activation of enzymes, and deregulation of gene expression via the RNA interference pathway. ATXN10/SCA10 is also known as ataxin-10, spinocerebellar ataxia type 10 protein, brain protein E46 homolog, E46L, and FLJ37990.

Alternate Names

ataxin 10, ataxin-10, Brain protein E46 homolog, E46L, FLJ37990, HUMEEP, SCA10spinocerebellar ataxia 10, Spinocerebellar ataxia type 10 protein

Gene Symbol

ATXN10

Additional Ataxin-10 Products

Product Documents for Ataxin-10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ataxin-10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ataxin-10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ataxin-10 Antibody - BSA Free and earn rewards!

Have you used Ataxin-10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...