ATF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38747

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATF1 Antibody - BSA Free

Western Blot: ATF1 Antibody [NBP2-38747]

Western Blot: ATF1 Antibody [NBP2-38747]

Western Blot: ATF1 Antibody [NBP2-38747] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATF1 antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: ATF1 Antibody [NBP2-38747]

Immunocytochemistry/ Immunofluorescence: ATF1 Antibody [NBP2-38747]

Immunocytochemistry/Immunofluorescence: ATF1 Antibody [NBP2-38747] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining in human thyroid gland and pancreas tissues using anti-ATF1 antibody. Corresponding ATF1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: ATF1 Antibody [NBP2-38747]

Immunohistochemistry: ATF1 Antibody [NBP2-38747]

Immunohistochemistry: ATF1 Antibody [NBP2-38747] - Staining of human kidney shows moderate nuclear positivity in renal tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747]

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human thyroid gland shows high expression.

Applications for ATF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATF1

ATF2 (Activating Transcription Factor 2, CREBP, HB16, CREB2, TREB7) is a member of the ATF/CREB family of basic region leucine zipper DNA binding proteins that regulates transcription by binding to a consensus cAMP response element (CRE) in the promoter of various viral and cellular genes. Many of these genes are important in cell growth and differentiation, and in stress and immune responses. ATF2 is a nuclear protein that binds DNA as a dimer and can form dimers with members of the ATF/CREB and Jun/Fos families. It is a stronger activator as a heterodimer with cJun than as a homodimer. Several isoforms of ATF2 arise by differential splicing. The stable native full length ATF2 is transcriptionally inactive as a result of an inhibitory direct intramolecular interaction of its carboxy terminal DNA binding domain with the amino terminal transactivation domain. Following dimerization ATF2 becomes a short lived protein that undergoes ubiquitination and proteolysis, seemingly in a protein phosphatase-dependent mechanism. Stimulation of the transcriptional activity of ATF2 occurs following cellular stress induced by several genotoxic agents, inflammatory cytokines, and UV irradiation. This activation requires phosphorylation of two threonine residues in ATF2 by both JNK/SAP kinase and p38 MAP kinase. ATF2 is abundantly expressed in brain.

Long Name

Activating Transcription Factor 1

Alternate Names

TREB36

Gene Symbol

ATF1

UniProt

P18846

Additional ATF1 Products

Product Documents for ATF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATF1 Antibody - BSA Free and earn rewards!

Have you used ATF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

TGF-beta Signaling Pathways TGF-beta Signaling Pathway Thumbnail