ATF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85816

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse, Rat

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, Chemotaxis, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816]

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816]

Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
ATF3 Antibody

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] -

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. A, Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a positive signal in nuclei of axotomized sensory neurons in ATF3+/+ mice, but not ATF3cre/cre mice. Note that the Santa Cruz antibody (C-19) labels neuronal nuclei in in the latter (inset), indicating non-specific staining. B, C, Axotomy induced reporter expression in sensory (DRG), sympathetic (stellate ganglion, SG), & motoneurons 4 d after injury. D, Reporter expression in sensory axons & motoneurons one week after injury. E, Preventing CreERT2 translocation from cytoplasm to nucleus with ICI 182780 reduces recombination in ATF3+ cells (by ∼50%). F, Recombination efficiency 16 d after injury was calculated by expressing the proportion of tracer-filled somata (labeled at the time of injury) that were also reporter (tdtomato)-positive. G, Recombination efficiencies at 4 & 16 d after injury (n = 3 for each time point) for DRG & motoneurons. Images in panels A, B, E were taken from whole mounts, those in C, D, F from cryosections. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ATF3 Antibody

Immunohistochemistry: ATF3 Antibody [NBP1-85816] -

Immunohistochemistry: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a sciatic nerve transection (SN injury) at 3 d post-injury stained for cJun, Isl1 (all neurons), & IB4. Arrows point to cJun-positive, IB4-negative neurons, & arrowheads point to cJun, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. B, Quantification of percentage of cJun-positive neurons from A. C, Immunohistochemistry of L4 DRG for Atf3, Isl1 (all neurons) & IB4. Arrows point to Atf3-positive, IB4-negative neurons & arrowheads point to Atf3, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. D, Quantification of percentage of Atf3-positive neurons from C. E, Western blotting of uninjured control & Tsc2 cKO L4/L5 DRG from mice receiving daily vehicle or rapamycin treatment for 3 d. F, Quantification of protein expression from E. Log2 fold change relative to uninjured control from the same biological replicate. N.S., not significant, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Extended Data Figure 5-1 shows data values of mean & SEM, number of replicates, statistical tests, & values for all comparisons. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31182472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ATF3 Antibody

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] -

Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy does not induce ATF3 in Schwann cells. A, Cryosections from injured DRG (inset) & distal sciatic nerve from the same mouse processed for ATF3 immunohistochemistry (Novus NBP1-85816). B, Punctate staining in the nerve proved to be non-specific fluorescence of leukocytes (note non-nuclear signal in the absence of primary antibody). C, In intact sciatic nerves, cells morphologically identical to Remak cells had at some point undergone recombination. D, Following injury, their numbers increased. E, This was attributable to their proliferation in the injured nerve (as opposed to ATF3 induction & subsequent recombination). C′, D′, Magnification of areas outlined in C & D demonstrate the spindle shaped morphology characteristic of Remak cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ATF3 Antibody - BSA Free Immunohistochemistry-Paraffin: ATF3 Antibody - BSA Free [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody - BSA Free [NBP1-85816]

Staining of mouse dorsal root ganglion shows strong nuclear immunoreactivity in single neurons.
ATF3 Antibody - BSA Free Immunohistochemistry-Paraffin: ATF3 Antibody - BSA Free [NBP1-85816]

Immunohistochemistry-Paraffin: ATF3 Antibody - BSA Free [NBP1-85816]

Staining of human skeletal muscle shows very weak nucleus-cytoplasmic positivity in myocytes.

Applications for ATF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 3 reviews rated 4.3 using NBP1-85816 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATF3

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.

Alternate Names

activating transcription factor 3cAMP-dependent transcription factor ATF-3, ATF3deltaZip2, ATF3deltaZip2c, ATF3deltaZip3, cyclic AMP-dependent transcription factor ATF-3

Gene Symbol

ATF3

Additional ATF3 Products

Product Documents for ATF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATF3 Antibody - BSA Free

Customer Reviews for ATF3 Antibody - BSA Free (3)

4.3 out of 5
3 Customer Ratings
5 Stars
33%
4 Stars
67%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ATF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • ATF3 Antibody
    Name: Felix Oppel
    Application: Indirect Immunofluorescence
    Sample Tested: Cell culture
    Species: Human
    Verified Customer | Posted 05/03/2022
    ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. Nuclei stained with DAPI (blue).
    ATF3 Antibody - BSA Free NBP1-85816
  • ATF3 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Optic nerve
    Species: Feline
    Verified Customer | Posted 10/19/2018
    Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was localized in the nucleus.
    ATF3 Antibody - BSA Free NBP1-85816
  • ATF3 Antibody
    Name: Joanne Steinauer
    Application: Immunohistochemistry-Frozen
    Sample Tested: Dorsal root ganglion
    Species: Rat
    Verified Customer | Posted 09/15/2017
    ATF3 in rat DRG 14 days after SNI
    Fixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.
    ATF3 Antibody - BSA Free NBP1-85816

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies