ATG4D Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37970

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ATG4D (NP_116274.3).

Sequence:
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATG4D Antibody - BSA Free

ATG4D Antibody

Western Blot: ATG4D Antibody [NBP3-37970] -

Western Blot: ATG4D Antibody [NBP3-37970] - Western blot analysis of various lysates using ATG4D Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
ATG4D Antibody

Immunocytochemistry/ Immunofluorescence: ATG4D Antibody [NBP3-37970] -

Immunocytochemistry/ Immunofluorescence: ATG4D Antibody [NBP3-37970] - Immunofluorescence analysis of U2OS cells using ATG4D Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ATG4D Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATG4D

ATG4D is a gene that codes for a protein expressed in the skeletal muscle and testis and is 474 amino acids long with a weight of approximately 53 kDa. ATG4D is a cysteine protease required for autophagy. ATG4D has been shown to have interactions with TAF12, CASP3, CASP8, GABARAP, and UBC in pathways such as the regulation of autophagy pathway.

Alternate Names

APG4 autophagy 4 homolog D, APG4 autophagy 4 homolog D (S. cerevisiae), APG4D, APG4-D, ATG4 autophagy related 4 homolog D (S. cerevisiae), AUTL4, AUT-like 4 cysteine endopeptidase, AUT-like 4, cysteine endopeptidase, AUT-like 4, cysteine endopeptidase (S. cerevisiae), autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D, cysteine protease ATG4D, cysteine protease involved in autophagy, EC 3.4.22, EC 3.4.22.-

Gene Symbol

ATG4D

Additional ATG4D Products

Product Documents for ATG4D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATG4D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATG4D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATG4D Antibody - BSA Free and earn rewards!

Have you used ATG4D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...