ATP6V1H Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85668

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP6V1H Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V1H Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668]

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
ATP6V1H Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ATP6V1H Antibody - BSA Free [NBP1-85668]

Immunocytochemistry/ Immunofluorescence: ATP6V1H Antibody - BSA Free [NBP1-85668]

Staining of human cell line U-2 OS shows localization to actin filaments.
ATP6V1H Antibody - BSA Free Western Blot: ATP6V1H Antibody - BSA Free [NBP1-85668]

Western Blot: ATP6V1H Antibody - BSA Free [NBP1-85668]

Analysis in control (vector only transfected HEK293T lysate) and ATP6V1H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for ATP6V1H Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1H

ATP6V1H, also known as V-type proton ATPase subunit H, is a 483 amino acid protein that is a subunit of the V1 complex, which is responsible for acidifying eukaryotic cells in intracellular organelles. Studies on this protein have shown a relationship with the following disorders and diseases, osteopetrosis, carcinoma, cholera, colon carcinoma, arthritis, rheumatoid arthritis, neuronitis, tuberculosis, and immunodeficiency. The ATP6V1H protein has also shown an interaction with ATP6V1D, ATP6V1F, ATP6V1B2, ATP6V1E1, and ETHE1 in the oxidative phosphorylation, metabolic, phagosome, lysosome, insulin receptor recycline, and Iron uptake and transport pathways.

Alternate Names

ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H, ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, CGI-11, MSTP042, NBP1, Nef-binding protein 1, Protein VMA13 homolog, SFD, SFDalpha, SFDbeta, vacuolar ATP synthase subunit H, vacuolar ATPase subunit H, vacuolar proton pump H subunit, Vacuolar proton pump subunit H, Vacuolar proton pump subunit SFD, V-ATPase 50/57 kDa subunits, V-ATPase H subunit, V-ATPase subunit H, VMA13, V-type proton ATPase subunit H

Gene Symbol

ATP6V1H

Additional ATP6V1H Products

Product Documents for ATP6V1H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP6V1H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATP6V1H Antibody - BSA Free

Customer Reviews for ATP6V1H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V1H Antibody - BSA Free and earn rewards!

Have you used ATP6V1H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies