Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17073

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Atrial Natriuretic Peptide/ANP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS

Reactivity Notes

Mouse (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Analysis in human heart muscle and duodenum tissues using Anti-NPPA antibody. Corresponding NPPA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073]

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Staining of human heart muscle shows high expression.

Applications for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Atrial Natriuretic Peptide/ANP

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Alternate Names

ANF, ANP, Cardionatrin, NPPA, PND

Gene Symbol

NPPA

Additional Atrial Natriuretic Peptide/ANP Products

Product Documents for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cardiac Stem Cell Markers

Customer Reviews for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Atrial Natriuretic Peptide/ANP Antibody - BSA Free and earn rewards!

Have you used Atrial Natriuretic Peptide/ANP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies