AUH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57375

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to AUH (AU RNA binding protein/enoyl-Coenzyme A hydratase) The peptide sequence was selected from the C terminal of AUH. Peptide sequence IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AUH Antibody - BSA Free

Western Blot: AUH Antibody [NBP1-57375]

Western Blot: AUH Antibody [NBP1-57375]

Western Blot: AUH Antibody [NBP1-57375] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: AUH Antibody [NBP1-57375]

Immunohistochemistry-Paraffin: AUH Antibody [NBP1-57375]

Immunohistochemistry-Paraffin: AUH Antibody [NBP1-57375] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for AUH Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AUH

AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form.AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form.

Alternate Names

3-methylglutaconyl-CoA hydratase, AU RNA binding protein/enoyl-CoA hydratase, AU RNA binding protein/enoyl-Coenzyme A hydratase, AU RNA-binding protein/enoyl-Coenzyme A hydratase, AU-binding protein/enoyl-CoA hydratase, AU-specific RNA-binding enoyl-CoA hydratase, EC 4.2.1.18, methylglutaconyl-CoA hydratase, mitochondrial

Gene Symbol

AUH

UniProt

Additional AUH Products

Product Documents for AUH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AUH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AUH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AUH Antibody - BSA Free and earn rewards!

Have you used AUH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...