Autoimmune Regulator/AIRE Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10950

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Autoimmune Regulator/AIRE Antibody - BSA Free

Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP3-10950]

Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP3-10950]

Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP3-10950] - Immunohistochemical analysis of paraffin-embedded human kidney tissue.

Applications for Autoimmune Regulator/AIRE Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Autoimmune Regulator/AIRE

AIRE encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CBP. At least three splice variant mRNAs products have been described including one which results in a premature stop codon and a transcript predicted to be a candidate for nuclear-mediated decay (NMD). Defects in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).

Alternate Names

AIRE, APECED, APS1, APSI, PGA1

Gene Symbol

AIRE

Additional Autoimmune Regulator/AIRE Products

Product Documents for Autoimmune Regulator/AIRE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Autoimmune Regulator/AIRE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Autoimmune Regulator/AIRE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Autoimmune Regulator/AIRE Antibody - BSA Free and earn rewards!

Have you used Autoimmune Regulator/AIRE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Autoimmune Regulator/AIRE Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking into a positive control for Western blotting. We are trying to detect the AIRE protein and are not sure whether the antibody we have is picking up the protein. Are you able to tell me whether the human thymus whole tissue lysate (NB820-59456) has been used to detect for AIRE expression by Western blotting?

    A:

    I am not currently aware of any references to the use of our human thymus whole tissue lysate being used to detect AIRE by Western blotting. On looking through the Western blot images for all seven of our AIRE antibodies, I see that these have been generated using lysates from RT-4 cells (bladder), U-251 MG cells (brain), 293 cells (human embryonic kidney), human spleen lysate, liver lysate and tonsil lysate. Additionally, you may find the Human Protein Atlas link to AIRE useful. At this site you can find protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines: The Human Protein Atlas.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...