B4GALT7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88652
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Hamster - Cricetulus (Chinese Hamster)
Predicted:
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG
Reactivity Notes
Chinese Hamster reactivity reported in scientific literature (PMID: 31278392).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for B4GALT7 Antibody - BSA Free
Western Blot: B4GALT7 Antibody [NBP1-88652]
Western Blot: B4GALT7 Antibody [NBP1-88652] - Analysis in human cell line HDLM-2.Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -
Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -
Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -
Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -
Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human skin shows no positivity in squamous epithelial cells as expected.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
Down-regulation of B4GALT7 results in DNA damage and arrests the cell cycle at the G2/M phase.(A–B) p-ATM and p-H2A. X protein levels in SNU-423 and SK-Hep-1 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. (C) Cell cycle analysis in SNU-423 and SK-Hep-1 cells after shRNA mediated B4GALT7 inhibition. Mean +/- SD for three independent experiments are demonstrated. (D–E) p-Chk2, p-Wee1, p-cdc2 and cyclin B1 protein levels in B4GALT7-downregulation SNU-423 and SK-Hep-1 cells, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
B4GALT7 is highly expressed in HCC tissues.(A) B4GALT7 expression levels in three GEO datasets, GSE14520, GSE25097 and GSE84402. (B) B4GALT7 levels in the TCGA database. (C) Survival probability of HCC patients with different expression of B4GALT7. The expression of B4GALT7 was analyzed by (D) western blotting and (E) real-time PCR in 10 pairs HCC samples and para-tumor specimens. (F) Representative immunohistochemical staining results of B4GALT7 based on the HPA database. (G) The expression landscape of B4GALT7 in the TIMER2.0 database. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
The effects of B4GALT7 and miR-338-3p on HCC cell invasion.(A) Matrigel-based transwell assay was conducted in HCC cells transfected with pEX-3/vector, pEX-3/B4GALT7, and co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (B) Western blotting assay revealed the expression levels of EMT marker proteins can be reversed when co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (C) Representative western blots of EMT marker protein levels in SNU-423 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
Down-regulation of B4GALT7 inhibits HCC cell proliferative abilities in vitro.(A) qPCR and (B) Western blotting analysis of the expression of B4GALT7 in HCC cells (SNU-423, SMMC-7721, SK-Hep-1, HepG2, Huh-7) and normal liver cell HL-7702. (C) Representative pictures of the green fluorescence intensity of HCC cells after transfected with shRNA vectors to mediate B4GALT7 inhibition. (D) qPCR and (E) Western blotting analysis of B4GALT7 expression in HCC cells after transfected as in C. Down-regulation of B4GALT7 inhibits the proliferative abilities of HCC cells (SNU-423, SK-Hep-1) determined by (F) MTT assay and (G) Colony formation assay. (H) Representative pictures of flow cytometry analysis of apoptosis stained with Annexin V-APC and 7-AAD in HCC cells transfected as in C. Scale bar: 100 um. Mean +/- SD for three independent experiments are demonstrated. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
Down-regulation of B4GALT7 inhibits HCC cell proliferative abilities in vitro.(A) qPCR and (B) Western blotting analysis of the expression of B4GALT7 in HCC cells (SNU-423, SMMC-7721, SK-Hep-1, HepG2, Huh-7) and normal liver cell HL-7702. (C) Representative pictures of the green fluorescence intensity of HCC cells after transfected with shRNA vectors to mediate B4GALT7 inhibition. (D) qPCR and (E) Western blotting analysis of B4GALT7 expression in HCC cells after transfected as in C. Down-regulation of B4GALT7 inhibits the proliferative abilities of HCC cells (SNU-423, SK-Hep-1) determined by (F) MTT assay and (G) Colony formation assay. (H) Representative pictures of flow cytometry analysis of apoptosis stained with Annexin V-APC and 7-AAD in HCC cells transfected as in C. Scale bar: 100 um. Mean +/- SD for three independent experiments are demonstrated. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
The reciprocal suppression effects of B4GALT7 and miR-338-3p.(A) The potential interaction between B4GALT7 and miR-338-3p predicted by TargetScan. (B) Expression levels of miR-338-3p in HCC cells (SNU-423, SK-Hep-1) and normal liver cell HL-7702. (C) Dual luciferase reporter assay demonstrated the luciferase activities in HEK-293T and SNU-423 cells following the indicated transfection. (D–E) Expression levels of miR-338-3p in SNU-423 and SK-Hep-1 cells with B4GALT7 overexpression and after shRNA mediated B4GALT7 inhibition. (F–G) qPCR and (H) Western blotting analysis of B4GALT7 expression in SNU-423 and SK-Hep-1 cells after transfected with miR-338-3p mimics and inhibitor. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
The effects of B4GALT7 and miR-338-3p on HCC cell invasion and migration.(A–B) Wound healing assay, matrigel-free and matrigel-based transwell assays were performed in SNU-423 and SK-Hep-1 cells transfected with shNC, shB4GALT7, and co-transfected with sh-B4GALT7 and the miR-338-3p inhibitor. Migration of the cells to the wound was photographed at 0 h and 48 h. Scale bar: 100 um. (C) Western blotting assay revealed the expression levels of EMT marker proteins and the phosphorylation status of signaling proteins can be rescued when co-transfected with sh-B4GALT7 and the miR-338-3p inhibitor. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -
The effects of B4GALT7 and miR-338-3p on HCC cell invasion.(A) Matrigel-based transwell assay was conducted in HCC cells transfected with pEX-3/vector, pEX-3/B4GALT7, and co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (B) Western blotting assay revealed the expression levels of EMT marker proteins can be reversed when co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (C) Representative western blots of EMT marker protein levels in SNU-423 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for B4GALT7 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 -1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: B4GALT7
Long Name
UDP-Gal:Beta-GlcNAc Beta-1,4-Galactosyltransferase 7
Alternate Names
b4Gal-T7, beta-1,4-galactosyltransferase 7, Beta-1,4-GalTase 7, beta4Gal-T7, beta4GalT-VII, EC 2.4.1.-, EDSP1, EDSSLA, EDSSPD1, proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7, XGALT1, XGALT-1, XGALT1beta-1,4-galactosyltransferase VII, XGPT, XGPT1, xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7(galactosyltransferase I)
Gene Symbol
B4GALT7
Additional B4GALT7 Products
Product Documents for B4GALT7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for B4GALT7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for B4GALT7 Antibody - BSA Free
Customer Reviews for B4GALT7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review B4GALT7 Antibody - BSA Free and earn rewards!
Have you used B4GALT7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...