Recombinant Mouse B7-1/CD80 Protein

Novus Biologicals | Catalog # NBP2-26578

Novus Biologicals
100% Guarantee

Key Product Details

Source

Baculovirus

Applications

Cell Depletion, SDS-PAGE
View all B7-1/CD80 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein corresponding to CD80.

Amino Acid Sequence: MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATL SCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDI TNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPT PSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETEL YAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK

Extracellular domain (amino acids 1-241) of human B7.1 sequence is underlined.

Human Fc sequence is in italics.

Purity

Protein A purified

Endotoxin Level

Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Predicted Molecular Mass

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

Can be used as an effective anti-tumor agent in combinantion with Treg depletion. May block binding of membrane bound B7.1 with its receptors, CD28 and CTLA-4, thereby sustaining the activation of tumor specific T cells or preventing their down regulation.

Application Notes

Can be used as an effective anti-tumor agent in combinantion with Treg depletion. May block binding of membrane bound B7.1 with its receptors, CD28 and CTLA-4, thereby sustaining the activation of tumor specific T cells or preventing their down regulation

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Mouse B7-1/CD80 Protein

SDS-PAGE: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578]

SDS-PAGE: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578]

SDS-Page: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578] - SDS-PAGE analysis of recombinant B7.1-Fc to demonstrate purity of protein.
Bioactivity: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578] - Effect of B7.1-Fc on the growth of tumor cells. B7.1-Fc fusion protein prevents growth of mouse solid tumor, RENCA. The immunotherapy is more more effective in combination with CD25+ depletion and B7.1-Fc fusion protein (PMID: 16322313)

Formulation, Preparation, and Storage

NBP2-26578
Formulation Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Concentration 2.0 mg/ml
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: B7-1/CD80

B7.1 is a transmembrane protein belonging to a family of costimulatory molecules expressed on the surface of antigen presenting cells (APCs). Binding of B7.1 to the T cell costimulatory receptors, CD28 and CTLA-4, is essential for the activation and regulation of T cell immunity. Mice deficient in B7.1 and B7.2 have profound deficits in both humoral immune responses (antibody production) and cellular immune responses. Soluble B7.1-Fc fusion protein can bind to human and murine T cells and stimulate their proliferation. Recently, B7.1-Fc fusion protein alone or in combination with anti-CD4+ or CD25+ depletion (depletion of Tregs) has been used in animal models to inhibit tumor growth.

Alternate Names

B71, CD80

Gene Symbol

CD80

Additional B7-1/CD80 Products

Product Documents for Recombinant Mouse B7-1/CD80 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Mouse B7-1/CD80 Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Mouse B7-1/CD80 Protein

There are currently no reviews for this product. Be the first to review Recombinant Mouse B7-1/CD80 Protein and earn rewards!

Have you used Recombinant Mouse B7-1/CD80 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes