BAF53A Antibody (5U6J8)

Novus Biologicals | Catalog # NBP3-16659

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5U6J8 expressed in HEK293
View all BAF53A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human BAF53A (O96019). FITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAF53A Antibody (5U6J8)

Western Blot: BAF53A Antibody (5U6J8) [NBP3-16659]

Western Blot: BAF53A Antibody (5U6J8) [NBP3-16659]

Western Blot: BAF53A Antibody (5U6J8) [NBP3-16659] - Western blot analysis of extracts of various cell lines, using BAF53A Rabbit mAb (NBP3-16659) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659] - Immunohistochemistry of paraffin-embedded mouse kidney using BAF53A Rabbit mAb (NBP3-16659) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659] - Immunohistochemistry of paraffin-embedded rat brain using BAF53A Rabbit mAb (NBP3-16659) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659] - Immunohistochemistry of paraffin-embedded human appendix using BAF53A Rabbit mAb (NBP3-16659) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659]

Immunohistochemistry-Paraffin: BAF53A Antibody (5U6J8) [NBP3-16659] - Immunohistochemistry of paraffin-embedded human esophageal cancer using BAF53A Rabbit mAb (NBP3-16659) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for BAF53A Antibody (5U6J8)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BAF53A

BAF53A encodes a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a 53 kDa subunit protein of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. Three transcript variants that encode two different protein isoforms have been described.

Alternate Names

actin-like 6A, actin-like protein 6A, actin-related protein 4,53 kDa BRG1-associated factor A, Actin-related protein Baf53a, Actl6, Arp4, ArpNbeta, BAF complex 53 kDa subunit, Baf53a, BAF53AACTL6, BAF53MGC5382, BRG1-associated factor 53A, hArpN beta, INO80 complex subunit K, INO80KARPN-BETA

Gene Symbol

ACTL6A

Additional BAF53A Products

Product Documents for BAF53A Antibody (5U6J8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BAF53A Antibody (5U6J8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAF53A Antibody (5U6J8)

There are currently no reviews for this product. Be the first to review BAF53A Antibody (5U6J8) and earn rewards!

Have you used BAF53A Antibody (5U6J8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies