Bay 55-9837

  ( 3 citations )    
Product Datasheet
Catalog Number:2711
Chemical Name:
Product Details
Citations (3)
Supplemental Products
Reviews
Biological Activity
Selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists.
Technical Data
  • M.Wt:
    3742.29
  • Formula:
    C167H270N52O46
  • Sequence:
    HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

    (Modifications: Tyr-31 = C-terminal amide)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    463930-25-8
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Bay 55-9837 include:

3 Citations: Showing 1 - 3
Filter your results:

  1. A subnanomolar concentration of Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) pre-synaptically modulates glutamatergic transmission in the rat hippocampus acting through acetylcholine
    Authors: Valeria Et al.
    Neuroscience  2016;340:551
  2. Regulation of AMPA receptor phosphorylation by the neuropeptide PACAP38.
    Authors: Toda and Huganir
    Purinergic Signal  2015;112:6712
  3. Chronic stimulation of the hypothalamic vasoactive intestinal peptide receptor lengthens circadian period in mice and hamsters.
    Authors: Pantazopoulos Et al.
    Am J Physiol Regul Integr Comp Physiol  2010;299:R379

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used Bay 55-9837?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee