Bay 55-9837

Catalog # Availability Size / Price Qty
2711/1
Bay 55-9837
1 Image
Description: Potent and selective VPAC2 agonist
Product Details
Citations (4)
Supplemental Products
Reviews

Biological Activity

Selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists.

Technical Data

Formula:
C167H270N52O46
Sequence:
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

(Modifications: Tyr-31 = C-terminal amide)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store the unopened product at -20 to -70 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Do not use past expiration date.
CAS No:
463930-25-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Citations for Bay 55-9837

The citations listed below are publications that use Tocris products. Selected citations for Bay 55-9837 include:

4 Citations: Showing 1 - 4

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

VersaClone cDNA Plasmids

Reviews for Bay 55-9837

There are currently no reviews for this product. Be the first to review Bay 55-9837 and earn rewards!

Have you used Bay 55-9837?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.