Catalog Number: 2711
Biological Activity
Selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists.
Technical Data
  • M.Wt:
    3742.29
  • Formula:
    C167H270N52O46
  • Sequence:
    HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

    (Modifications: Tyr-31 = C-terminal amide)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    463930-25-8
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Engineering of a VPAC2 receptor peptide agonist to impart dipeptidyl peptidase IV stability and enhance in vivo glucose disposal.
    Clairmont et al.
    J.Med.Chem., 2006;49:7545
  2. A potent and highly selective VPAC2 agonist enhances glucose-induced insulin release and glucose disposal: a potential therapy for type 2 diabetes.
    Tsutsumi et al.
    Diabetes, 2002;51:1453
  3. Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo.
    Pan et al.
    J.Pharmacol.Exp.Ther., 2007;320:900
  4. Macrophage resistance to HIV-1 infection is enhanced by the neuropeptides VIP and PACAP.
    Temerozo et al.
    PLoS ONE, 2013;8:67701
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Bay 55-9837 include:

3 Citations: Showing 1 - 3
Filter your results:

  1. A subnanomolar concentration of Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) pre-synaptically modulates glutamatergic transmission in the rat hippocampus acting through acetylcholine
    Authors: Valeria Et al.
    Neuroscience 2016;340:551
  2. Regulation of AMPA receptor phosphorylation by the neuropeptide PACAP38.
    Authors: Toda and Huganir
    Purinergic Signal 2015;112:6712
  3. Chronic stimulation of the hypothalamic vasoactive intestinal peptide receptor lengthens circadian period in mice and hamsters.
    Authors: Pantazopoulos Et al.
    Am J Physiol Regul Integr Comp Physiol 2010;299:R379

Have you used Bay 55-9837?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information