BCAS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49532

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BCAS2 Antibody - BSA Free

Western Blot: BCAS2 Antibody [NBP2-49532]

Western Blot: BCAS2 Antibody [NBP2-49532]

Western Blot: BCAS2 Antibody [NBP2-49532] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: BCAS2 Antibody [NBP2-49532]

Immunocytochemistry/ Immunofluorescence: BCAS2 Antibody [NBP2-49532]

Immunocytochemistry/Immunofluorescence: BCAS2 Antibody [NBP2-49532] - Staining of human cell line U-2 OS shows localization to nuclear speckles & centrosome.
Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining in human thyroid gland and pancreas tissues using anti-BCAS2 antibody. Corresponding BCAS2 RNA-seq data are presented for the same tissues.
Immunohistochemistry: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry: BCAS2 Antibody [NBP2-49532] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532]

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining of human thyroid gland shows high expression.

Applications for BCAS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BCAS2

BCAS2 is a Ubiquitously expressed nuclear protein associated with the splicesome. The deduced 225-amino acid protein contains a central potential N-glycosylation site and multiple N-terminal potential phosphorylation sites. Northern and Southern blot analyses demonstrates expression of a 1.5-kb transcript at various levels in multiple breast cancer cell lines, with greatest amplification in BT-20 and MCF-7 cells.

Alternate Names

breast carcinoma amplified sequence 2, Breast carcinoma-amplified sequence 2, DAM1DNA amplified in mammary carcinoma 1 protein, pre-mRNA-splicing factor SPF27, Snt309, SPF27, spliceosome associated protein, amplified in breast cancer, Spliceosome-associated protein SPF 27

Gene Symbol

BCAS2

Additional BCAS2 Products

Product Documents for BCAS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BCAS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BCAS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BCAS2 Antibody - BSA Free and earn rewards!

Have you used BCAS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...