BCAS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38090

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BCAS2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human BCAS2 (NP_005863.1).

Sequence:
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BCAS2 Antibody - BSA Free

BCAS2 Antibody

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] -

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
BCAS2 Antibody

Western Blot: BCAS2 Antibody [NBP3-38090] -

Western Blot: BCAS2 Antibody [NBP3-38090] - Western blot analysis of various lysates using BCAS2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
BCAS2 Antibody

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] -

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
BCAS2 Antibody

Immunocytochemistry/ Immunofluorescence: BCAS2 Antibody [NBP3-38090] -

Immunocytochemistry/ Immunofluorescence: BCAS2 Antibody [NBP3-38090] - Confocal immunofluorescence analysis of U2OS cells using BCAS2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
BCAS2 Antibody

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] -

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for BCAS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BCAS2

BCAS2 is a Ubiquitously expressed nuclear protein associated with the splicesome. The deduced 225-amino acid protein contains a central potential N-glycosylation site and multiple N-terminal potential phosphorylation sites. Northern and Southern blot analyses demonstrates expression of a 1.5-kb transcript at various levels in multiple breast cancer cell lines, with greatest amplification in BT-20 and MCF-7 cells.

Alternate Names

breast carcinoma amplified sequence 2, Breast carcinoma-amplified sequence 2, DAM1DNA amplified in mammary carcinoma 1 protein, pre-mRNA-splicing factor SPF27, Snt309, SPF27, spliceosome associated protein, amplified in breast cancer, Spliceosome-associated protein SPF 27

Gene Symbol

BCAS2

Additional BCAS2 Products

Product Documents for BCAS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BCAS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BCAS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BCAS2 Antibody - BSA Free and earn rewards!

Have you used BCAS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies