BCKDHB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86326

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BCKDHB Antibody - BSA Free

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326]

Immunohistochemistry-Paraffin: BCKDHB Antibody [NBP1-86326] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
BCKDHB Antibody - BSA Free Western Blot: BCKDHB Antibody - BSA Free [NBP1-86326]

Western Blot: BCKDHB Antibody - BSA Free [NBP1-86326]

Analysis in control (vector only transfected HEK293T lysate) and BCKDHB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for BCKDHB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BCKDHB

Branched-chain keto acid dehydrogenase is a multienzyme complex associated with the inner membrane of mitochondria, andfunctions in the catabolism of branched-chain amino acids. The complex consists of multiple copies of 3 components:branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes the E1 beta subunit, and mutations therein have been associated with maple syrup urine disease(MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physicalretardation, and feeding problems. Alternative splicing at this locus results in transcript variants with different3' non-coding regions, but encoding the same isoform. (provided by RefSeq)

Alternate Names

2-oxoisovalerate dehydrogenase beta subunit, 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, BCKDE1B, BCKDH E1-beta, branched chain alpha-ketoacid dehydrogenase E1-beta subunit, branched chain keto acid dehydrogenase E1, beta polypeptide, Branched-chain alpha-keto acid dehydrogenase E1 component beta chain, dJ279A18.1, E1B, E1b-beta subunit of the branched-chain complex, EC 1.2.4.4, FLJ17880

Gene Symbol

BCKDHB

Additional BCKDHB Products

Product Documents for BCKDHB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BCKDHB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BCKDHB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BCKDHB Antibody - BSA Free and earn rewards!

Have you used BCKDHB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...