Bcl G Antibody (6R9F3)

Novus Biologicals | Catalog # NBP3-15746

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6R9F3 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Bcl G (Q9BZR8). MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTIT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Bcl G Antibody (6R9F3)

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746]

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746]

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746] - Western blot analysis of extracts of various cell lines, using BCL2L14/Bcl G antibody (NBP3-15746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746]

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746]

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746] - Western blot analysis of extracts of various cell lines, using BCL2L14/Bcl G antibody (NBP3-15746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded human colon tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded rat testis tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded mouse testis tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded Human lung adenocarcinoma tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded mouse kidney tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Bcl G Antibody (6R9F3)

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] -

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded rat kidney tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Applications for Bcl G Antibody (6R9F3)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Bcl G

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, and Hrk, form a growing subclass of the Bcl-2 family. A novel BH3 domain containing protein was recently identified and designated Bcl-G. The mRNA of Bcl-G encodes 2 isoforms, Bcl-GL, which is widely expressed in multiple tissues, and Bcl-GS, which is only found in testis. The Bcl-GS protein is predominantly localized to cytoplasmic organelles whereas Bcl-GL was distributed throughout the cytosol. Overexpression of either protein induced apoptosis, although Bcl-GS was far more potent than Bcl-GS. Apoptosis induction was dependent on the BH3 domain and could be suppressed by co-expression with the anti-apoptotic Bcl-XL protein.

Alternate Names

apoptosis facilitator Bcl-2-like protein 14, Apoptosis regulator Bcl-G, Bcl2-L-14, BCL2-like 14 (apoptosis facilitator), BCL-G, BCLGbcl2-L-14

Gene Symbol

BCL2L14

Additional Bcl G Products

Product Documents for Bcl G Antibody (6R9F3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Bcl G Antibody (6R9F3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Bcl G Antibody (6R9F3)

There are currently no reviews for this product. Be the first to review Bcl G Antibody (6R9F3) and earn rewards!

Have you used Bcl G Antibody (6R9F3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...