beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59007

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Rat

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30660767).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug HepG2 lysate
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Heart Antibody Dilution: 1.0ug/ml.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Lung Antibody Dilution: 1.0ug/m.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Muscle Antibody Dilution: 1.0ug/ml
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Adult Placenta Antibody Dilution: 1.0ug/ml.

Applications for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-1 Adrenergic R/ADRB1

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Beta-1 Adrenergic Receptor

Alternate Names

ADRB1, ADRB1R, beta-1 AdrenergicR, beta1 AdrenergicR

Gene Symbol

ADRB1

UniProt

Additional beta-1 Adrenergic R/ADRB1 Products

Product Documents for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Customer Reviews for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta-1 Adrenergic R/ADRB1 Antibody - BSA Free and earn rewards!

Have you used beta-1 Adrenergic R/ADRB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...