Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59531

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HSD3B2(hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2) The peptide sequence was selected from the N terminal of HSD3B2. Peptide sequence GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - 293T cells lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus Gene name: HSD3B2 Submitted by: Jonathan Bertin, Endoceutics Inc.
Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531]

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus Gene name: HSD3B2 Submitted by: Jonathan Bertin, Endoceutics Inc.

Applications for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Beta Hydroxysteroid Dehydrogenase

3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Alternate Names

3 beta-HSD type II, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, delta 5-delta 4-isomerase type II, HSD3B, HSDB, HSDB3B, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase, progesterone reductase, SDR11E2, short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase

Gene Symbol

HSD3B2

UniProt

Additional Beta Hydroxysteroid Dehydrogenase Products

Product Documents for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free and earn rewards!

Have you used Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...