Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
Novus Biologicals | Catalog # H00000639-Q01
![SDS-PAGE: Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein [H00000639-Q01]](https://resources.rndsystems.com/images/products/Recombinant-Human-BLIMP1-PRDM1-Protein-SDS-Page-H00000639-Q01-img0001.jpg "SDS-PAGE: Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein [H00000639-Q01]")
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
SDS-PAGE: Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein [H00000639-Q01]
SDS-Page: Recombinant Human BLIMP1/PRDM1 Protein [H00000639-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation, and Storage
H00000639-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: BLIMP1/PRDM1
Long Name
Alternate Names
Gene Symbol
Additional BLIMP1/PRDM1 Products
Product Documents for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein
-
Q: Will this protein bind DNA? I would like to use it in gel-shift assays. It says it comprises zinc finger domain, amino acids 1-110, but unclear to me if it can bind DNA.
A: This product is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody. While some of their proteins do show biological activity, unfortunately, because they are not directly tested for this, there is no way to predict whether or not this particular product shows biological activity.