BLNK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14355

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BLNK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BLNK Antibody - BSA Free

Western Blot: BLNK Antibody [NBP2-14355]

Western Blot: BLNK Antibody [NBP2-14355]

Western Blot: BLNK Antibody [NBP2-14355] - Analysis in control (vector only transfected HEK293T lysate) and BLNK over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: BLNK Antibody [NBP2-14355]

Immunocytochemistry/ Immunofluorescence: BLNK Antibody [NBP2-14355]

Immunocytochemistry/Immunofluorescence: BLNK Antibody [NBP2-14355] - Staining of human cell line REH shows localization to plasma membrane & cytoplasmic bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355] - Staining in human lymph node and pancreas tissues using anti-BLNK antibody. Corresponding BLNK RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355]

Immunohistochemistry-Paraffin: BLNK Antibody [NBP2-14355] - Staining of human pancreas shows low expression as expected.

Applications for BLNK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BLNK

B-cell linker protein (BLNK, also known as SLP65, BASH, and BCA) is a B cell adaptor that plays an important role in B cell development and in BCR-signal transduction. Since BLNK does not encode any intrinsic enzymatic activity, its function is to serve as a scaffold for assembling macromolecular complexes which includes enzymes (PLC gamma, Vav and Btk) and additional linker proteins (Grb2 and Nck) (1-3). In addition, BLNK binds Btk and is required for activation of the transcription factor NF-

Long Name

B-cell Linker Protein

Alternate Names

BASH, Ly57, SLP65

Gene Symbol

BLNK

Additional BLNK Products

Product Documents for BLNK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BLNK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BLNK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BLNK Antibody - BSA Free and earn rewards!

Have you used BLNK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies