BMP-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56251

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BMP-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BMP-2 Antibody - BSA Free

Western Blot: BMP-2 Antibody [NBP2-56251]

Western Blot: BMP-2 Antibody [NBP2-56251]

Western Blot: BMP-2 Antibody [NBP2-56251] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: BMP-2 Antibody [NBP2-56251]

Immunocytochemistry/ Immunofluorescence: BMP-2 Antibody [NBP2-56251]

Immunocytochemistry/Immunofluorescence: BMP-2 Antibody [NBP2-56251] - Staining of human cell line RT4 shows localization to vesicles. Antibody staining is shown in green.

Applications for BMP-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BMP-2

Bone morphogenic proteins (BMPs) are members of the TGFbeta superfamily. BMPs are involved in the induction of cartilage and bone formation. In vivo studies have shown that BMP-2 (also designated BMP-2A) and BMP-3 can independently induce cartilage formation. Smad3 association with the TGFbeta receptor complex and Smad1 translocation to the nucleus are observed after the addition of BMP-4 (also designated BMP-2B), suggesting that BMP-4 may play a role in activation of the Smad pathway. BMP-5, BMP-6 and BMP-7 all share high sequence homology with BMP-2, indicating that they each may be able to induce cartilage formation. BMP-8 (also designated OP-2) is thought to be involved in early development, as detectable expression has not been found in adult organs.

Long Name

Bone Morphogenetic Protein 2

Alternate Names

BDA2, BMP2, SSFSC

Gene Symbol

BMP2

Additional BMP-2 Products

Product Documents for BMP-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BMP-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BMP-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BMP-2 Antibody - BSA Free and earn rewards!

Have you used BMP-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMP-2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am interested in Bone Morphogenic Protein 2 (BMP-2) for clinical trial in humans. I am using this protein in stem cells culture for future use in humans. Do you have BMP-2 in pharma grade that I can use for humans?

    A: Our antibodies are for research purposes only unfortunately. I am sorry we cannot be of further help.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies