BOK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92315

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BOK (NP_115904.1). MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BOK Antibody - BSA Free

Western Blot: BOK AntibodyAzide and BSA Free [NBP2-92315]

Western Blot: BOK AntibodyAzide and BSA Free [NBP2-92315]

Western Blot: BOK Antibody [NBP2-92315] - Analysis of extracts of various cell lines, using BOK antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody [NBP2-92315] - Rat ovary using BOK Rabbit pAb (NBP2-92315) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody [NBP2-92315] - Mouse spleen using BOK antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody - Azide and BSA Free [NBP2-92315]

Immunohistochemistry-Paraffin: BOK Antibody [NBP2-92315] - Rat lung using BOK Rabbit pAb (NBP2-92315) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
BOK Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: BOK Antibody - Azide and BSA Free [NBP2-92315] -

Immunocytochemistry/ Immunofluorescence: BOK Antibody - Azide and BSA Free [NBP2-92315] - Immunofluorescence analysis of MCF7 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
BOK Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: BOK Antibody - Azide and BSA Free [NBP2-92315] -

Immunocytochemistry/ Immunofluorescence: BOK Antibody - Azide and BSA Free [NBP2-92315] - Immunofluorescence analysis of NIH/3T3 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
BOK Antibody - Azide and BSA Free

Western Blot: BOK Antibody - Azide and BSA Free [NBP2-92315] -

Western Blot: BOK Antibody - Azide and BSA Free [NBP2-92315] - Western blot analysis of various lysates using BOK Rabbit pAb at 1:10000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC): U-937
Exposure time: 90s.

Applications for BOK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BOK

Apoptosis or programmed cell death is a physiological cellular process characterized by cell shrinkage, membrane blebbing, DNA fragmentation, and release of Cytochrome C from the mitochondria. It is utilized by the organism to get rid of unwanted cells, which is critical for normal development and homeostasis of an organism. Disregulation of normal apoptosis process have been implicated in a variety of diseases, including cancer, autoimmune diseases, viral infections, etc. Programmed cell death occurs through complex cascades of cell signaling in which Bcl-2 family members, among others, play an important role.The Bcl-2 family of proteins regulate apoptosis as well as execute death signals at the mitochondrion. Members of this family include both pro- and anti-apoptotic proteins that hare homology sequences called Bcl-2 Homology domains (BH1-4) which mediate dimmer formation. The BH3 proteins, such as BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence homology within the amphipathic alpha-helical BH3 region, which is required for their apoptotic function. They may trigger release of death-inducing molecules such as Cytochrome C, Smac, and endonuclease G. Anti-apoptotic family members, including Bcl-2 and Bcl-XL, play inhibitory roles. Bcl-2 family proteins may form homodimers or heterodimers between pro- and anti-apoptotic members, the ratios of which determine the cell fate.

Long Name

Bcl-2-related Ovarian Killer

Alternate Names

bcl2-L-9, BCL2L9bcl-2-related ovarian killer protein, Bcl-2-like protein 9, BCL2-related ovarian killer, BOKL, hBOK, MGC4631

Gene Symbol

BOK

Additional BOK Products

Product Documents for BOK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BOK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for BOK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BOK Antibody - BSA Free and earn rewards!

Have you used BOK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...