Borealin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89951

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Borealin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Borealin Antibody [NBP1-89951]

Immunocytochemistry/ Immunofluorescence: Borealin Antibody [NBP1-89951]

Immunocytochemistry/Immunofluorescence: Borealin Antibody [NBP1-89951] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Borealin Antibody - BSA Free Immunohistochemistry-Paraffin: Borealin Antibody - BSA Free [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody - BSA Free [NBP1-89951]

Analysis in human testis and skeletal muscle tissues using NBP1-89951 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Borealin Antibody - BSA Free Immunohistochemistry-Paraffin: Borealin Antibody - BSA Free [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody - BSA Free [NBP1-89951]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]

Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human lymphoid tissues shows moderate nuclear positivity in germinal center cells.
Borealin Antibody - BSA Free Western Blot: Borealin Antibody - BSA Free [NBP1-89951]

Western Blot: Borealin Antibody - BSA Free [NBP1-89951]

Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Borealin Antibody

Western Blot: Borealin Antibody [NBP1-89951] -

Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Western Blot: Borealin Antibody [NBP1-89951]

Western Blot: Borealin Antibody [NBP1-89951]

Borealin-Antibody-Western-Blot-NBP1-89951-img0018.jpg
Western Blot: Borealin Antibody [NBP1-89951]

Western Blot: Borealin Antibody [NBP1-89951]

Borealin-Antibody-Western-Blot-NBP1-89951-img0017.jpg
Borealin Antibody

Western Blot: Borealin Antibody [NBP1-89951] -

Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Borealin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Borealin

Borealin (CDCA8) is a component of the chromosomal passenger complex (CPC), which is required for stability of the bipolar mitotic spindle and acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA.

Borealin has been shown to interact with Aurora B and survivin (BIRC5). Knockdown of Borealin by small interfering RNA resulted in severe chromosome misalignment at metaphase and accumulation of multiple interphase nuclei. Borealin is also related to the proliferation of human embryonic stem (hES) cells and is highly expressed in mouse undifferentiated ES cells.
Borealin antibodies are useful tools for stem cell studies and cell division research.

Alternate Names

BOR, BOREALIN, cell division cycle associated 8, Cell division cycle-associated protein 8, Dasra B, DasraB, dasra-B, FLJ10468, FLJ12042, hDasra-B, MESRGP, PESCRG3, Pluripotent embryonic stem cell-related gene 3 protein

Gene Symbol

CDCA8

Additional Borealin Products

Product Documents for Borealin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Borealin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Borealin Antibody - BSA Free

Customer Reviews for Borealin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Borealin Antibody - BSA Free and earn rewards!

Have you used Borealin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...