Borealin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89951
Loading...
Key Product Details
Validated by
Orthogonal Validation, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Borealin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Borealin Antibody [NBP1-89951]
Immunocytochemistry/Immunofluorescence: Borealin Antibody [NBP1-89951] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: Borealin Antibody - BSA Free [NBP1-89951]
Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951]
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human lymphoid tissues shows moderate nuclear positivity in germinal center cells.Western Blot: Borealin Antibody - BSA Free [NBP1-89951]
Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Western Blot: Borealin Antibody [NBP1-89951] -
Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Borealin Antibody [NBP1-89951]
Borealin-Antibody-Western-Blot-NBP1-89951-img0018.jpgWestern Blot: Borealin Antibody [NBP1-89951] -
Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Borealin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Borealin
Borealin has been shown to interact with Aurora B and survivin (BIRC5). Knockdown of Borealin by small interfering RNA resulted in severe chromosome misalignment at metaphase and accumulation of multiple interphase nuclei. Borealin is also related to the proliferation of human embryonic stem (hES) cells and is highly expressed in mouse undifferentiated ES cells.
Borealin antibodies are useful tools for stem cell studies and cell division research.
Alternate Names
BOR, BOREALIN, cell division cycle associated 8, Cell division cycle-associated protein 8, Dasra B, DasraB, dasra-B, FLJ10468, FLJ12042, hDasra-B, MESRGP, PESCRG3, Pluripotent embryonic stem cell-related gene 3 protein
Gene Symbol
CDCA8
Additional Borealin Products
Product Documents for Borealin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Borealin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Borealin Antibody - BSA Free
Customer Reviews for Borealin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Borealin Antibody - BSA Free and earn rewards!
Have you used Borealin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...