BPHL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88373

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BPHL Antibody - BSA Free

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373] - Staining in human kidney and skeletal muscle tissues using anti-BPHL antibody. Corresponding BPHL RNA-seq data are presented for the same tissues.
Western Blot: BPHL Antibody [NBP1-88373]

Western Blot: BPHL Antibody [NBP1-88373]

Western Blot: BPHL Antibody [NBP1-88373] - Analysis using Anti-BPHL antibody NBP1-88373 (A) shows similar pattern to independent antibody NBP2-38328 (B).
Immunocytochemistry/ Immunofluorescence: BPHL Antibody [NBP1-88373]

Immunocytochemistry/ Immunofluorescence: BPHL Antibody [NBP1-88373]

Immunocytochemistry/Immunofluorescence: BPHL Antibody [NBP1-88373] - Staining of human cell line PC-3 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373]

Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373] - Staining of human skeletal muscle shows low expression as expected.

Applications for BPHL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BPHL

The serine hydrolases, including BPHL, are defined as a functional class of hydrolytic enzymes that contain a serine residue in their active site. They can be grouped into subfamilies that contain closely related members in terms of substrate specificity or amino acid sequence similarity (Puente and Lopez-Otin, 1995 [PubMed 7759552]).[supplied by OMIM]

Alternate Names

biphenyl hydrolase-like (serine hydrolase), Biphenyl hydrolase-like protein, Biphenyl hydrolase-related protein, Bph-rp, Breast epithelial mucin-associated antigen, EC 3.1, MCNAA, MGC125930, MGC41865, VACVASE, valacyclovir hydrolase, valacyclovirase

Gene Symbol

BPHL

Additional BPHL Products

Product Documents for BPHL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BPHL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BPHL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BPHL Antibody - BSA Free and earn rewards!

Have you used BPHL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...