BRMS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35476

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 90-210 of human BRMS1 (NP_056214.1).

Sequence:
LEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BRMS1 Antibody - BSA Free

BRMS1 Antibody

Western Blot: BRMS1 Antibody [NBP3-35476] -

Western Blot: BRMS1 Antibody [NBP3-35476] - Western blot analysis of various lysates using BRMS1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
BRMS1 Antibody

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] -

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] - Immunohistochemistry analysis of paraffin-embedded Rat liver using BRMS1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
BRMS1 Antibody

Immunocytochemistry/ Immunofluorescence: BRMS1 Antibody [NBP3-35476] -

Immunocytochemistry/ Immunofluorescence: BRMS1 Antibody [NBP3-35476] - Immunofluorescence analysis of H9C2 cells using BRMS1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
BRMS1 Antibody

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] -

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using BRMS1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
BRMS1 Antibody

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] -

Immunohistochemistry: BRMS1 Antibody [NBP3-35476] - Immunohistochemistry analysis of paraffin-embedded Human colon using BRMS1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for BRMS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BRMS1

BRMS1 reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

breast cancer metastasis suppressor 1, breast cancer metastasis-suppressor 1, DKFZP564A063

Gene Symbol

BRMS1

Additional BRMS1 Products

Product Documents for BRMS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRMS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRMS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRMS1 Antibody - BSA Free and earn rewards!

Have you used BRMS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...