BRP44 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15977

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all BRP44 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-60 of human BRP44 (NP_056230.1). MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BRP44 Antibody - Azide and BSA Free

Western Blot: BRP44 AntibodyAzide and BSA Free [NBP3-15977]

Western Blot: BRP44 AntibodyAzide and BSA Free [NBP3-15977]

Western Blot: BRP44 Antibody [NBP3-15977] - Western blot analysis of extracts of Mouse kidney, using BRP44 antibody (NBP3-15977) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: BRP44 Antibody - Azide and BSA Free [NBP3-15977]

Immunohistochemistry-Paraffin: BRP44 Antibody - Azide and BSA Free [NBP3-15977]

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP3-15977] - Immunohistochemistry of paraffin-embedded mouse liver using BRP44 Rabbit pAb (NBP3-15977) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for BRP44 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BRP44

Long Name

Mitochondrial pyruvate carrier 2

Alternate Names

Brain protein 44, MPC2

Gene Symbol

MPC2

Additional BRP44 Products

Product Documents for BRP44 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRP44 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for BRP44 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review BRP44 Antibody - Azide and BSA Free and earn rewards!

Have you used BRP44 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies