BSND Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49101

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BSND Antibody - BSA Free

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining in human kidney and liver tissues using NBP2-49101 antibody. Corresponding BSND RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Barttin is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Antibody at 1:1000. Nuclei stained with DAPI. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney, liver, salivary gland and skeletal muscle using Anti-BSND antibody NBP2-49101 (A) shows similar protein distribution across tissues to independent antibody NBP2-62634 (B).
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]

Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for BSND Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP2-49101 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BSND

BSND encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.

Alternate Names

BARTMGC119284, Bartter syndrome, infantile, with sensorineural deafness (Barttin), barttin, deafness, autosomal recessive 73, DFNB73, MGC119283, MGC119285

Gene Symbol

BSND

Additional BSND Products

Product Documents for BSND Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BSND Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BSND Antibody - BSA Free

Customer Reviews for BSND Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used BSND Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • BSND Antibody
    Name: Edward van Beelen
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Mouse inner ear
    Species: Mouse
    Verified Customer | Posted 06/30/2020
    Barttin (NBP2-49101, 1:1000) is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Nuclei stained with DAPI.
    BSND Antibody - BSA Free NBP2-49101

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...