C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57665

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CTRP3/C1qTNF3/CORS26 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: C1qTNF3/CORS26/CTRP3 Antibody [NBP2-57665]

Immunocytochemistry/ Immunofluorescence: C1qTNF3/CORS26/CTRP3 Antibody [NBP2-57665]

Immunocytochemistry/Immunofluorescence: C1qTNF3/CORS26/CTRP3 Antibody [NBP2-57665] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.

Applications for C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTRP3/C1qTNF3/CORS26

Adipose tissue of an organism plays a major role in regulating physiologic and pathologic processes such as metabolism and immunity by producing and secreting a variety of bioactive molecules termed adipokines. One highly conserved family of adipokines is adiponectin/ACRP30 and its structural and functional paralogs, the C1q/tumor necrosis factor-alpha-related proteins (CTRPs) 1-7. Unlike adiponectin, which is expressed exclusively by differentiated adipocytes, the CTRPs are expressed in a wide variety of tissues. An analysis of the crystal structure of adiponectin revealed a structural and evolutionary link between TNF and C1q-containing proteins, suggesting that these proteins arose from a common ancestral innate immunity gene. Multiple isoforms of human CTRP3 have been reported. It has been suggested that CTRP3 may play a role in skeletal development.

Long Name

C1q and Tumor Necrosis Factor-related Protein 3

Alternate Names

C1qTNF3, Cartducin, CORS26

Gene Symbol

C1QTNF3

Additional CTRP3/C1qTNF3/CORS26 Products

Product Documents for C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for C1qTNF3/CORS26/CTRP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review C1qTNF3/CORS26/CTRP3 Antibody - BSA Free and earn rewards!

Have you used C1qTNF3/CORS26/CTRP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies