CACNA1S Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33541

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CACNA1S Antibody - BSA Free

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Analysis in human skeletal muscle and prostate tissues. Corresponding CACNA1S RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human prostate shows no positivity in smooth muscle cells as expected.
Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541]

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Applications for CACNA1S Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CACNA1S

Voltage-sensitive calcium channels mediate the entry of calcium into many types of excitable cells and thus play a key role in neurotransmitter release and excitation-contraction (E-C) coupling. The 1,4-dihydropyridines (DHPs) are synthetic organic compounds which can be used to identify the L-type calcium channels that are found in all types of vertebrate muscle, neuronal and neuroendocrine cells. The DHP receptor is part of the L-type calcium channel complex and is thought to be the voltage sensor in E-C coupling.The purified DHP receptor isolated from triads is composed of at least four subunits. The alpha-1 subunit contains the binding site for the DHPs and shows high sequence homology to the voltage gated sodium channel. The alpha-2 subunit is a large glycoprotein associated with the DHP receptor which was first described in skeletal muscle and is also found in high concentrations in other excitable tissues such as cardiac muscle and brain and in low concentrations in most other tissues studied. The other two subunits that co-purify with the DHP receptor are termed beta and gamma.

Long Name

Voltage-dependent L-type calcium channel subunit alpha-1S

Alternate Names

CACH1, CACN1, CACNL1A3, Cav1.1, MHS5

Gene Symbol

CACNA1S

UniProt

Additional CACNA1S Products

Product Documents for CACNA1S Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CACNA1S Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CACNA1S Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CACNA1S Antibody - BSA Free and earn rewards!

Have you used CACNA1S Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...