CaM Kinase II gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57797

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CaM Kinase II gamma Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CaM Kinase II gamma Antibody - BSA Free

Western Blot: CaM Kinase II gamma Antibody [NBP2-57797]

Western Blot: CaM Kinase II gamma Antibody [NBP2-57797]

Western Blot: CaM Kinase II gamma Antibody [NBP2-57797] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP2-57797]

Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP2-57797]

Immunocytochemistry/Immunofluorescence: CaM Kinase II gamma Antibody [NBP2-57797] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Applications for CaM Kinase II gamma Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CaM Kinase II gamma

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Six alternatively spliced variants that encode six different isoforms have been characterized to date. Additional alternative splice variants that encode different isoforms have been described, but their full-length nature has not been determined.

Long Name

Calcium/calmodulin-dependent Protein Kinase II gamma Subunit

Alternate Names

CAMK2G, CAMKG

Gene Symbol

CAMK2G

Additional CaM Kinase II gamma Products

Product Documents for CaM Kinase II gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CaM Kinase II gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CaM Kinase II gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CaM Kinase II gamma Antibody - BSA Free and earn rewards!

Have you used CaM Kinase II gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies