Carboxypeptidase A2/CPA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86028

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carboxypeptidase A2/CPA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028] - Staining in human pancreas and liver tissues using anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-86028] - Staining of human testis.
Carboxypeptidase A2/CPA2 Antibody - BSA Free Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Carboxypeptidase A2/CPA2 Antibody - BSA Free Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Staining of human kidney shows no positivity in cells in tubules as expected.
Carboxypeptidase A2/CPA2 Antibody - BSA Free Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody NBP1-86028 (A) shows similar protein distribution across tissues to independent antibody NBP1-87555 (B).
Carboxypeptidase A2/CPA2 Antibody - BSA Free Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody - BSA Free [NBP1-86028]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Applications for Carboxypeptidase A2/CPA2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carboxypeptidase A2/CPA2

Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues [provided by RefSeq]

Alternate Names

CPA2

Gene Symbol

CPA2

Additional Carboxypeptidase A2/CPA2 Products

Product Documents for Carboxypeptidase A2/CPA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carboxypeptidase A2/CPA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Carboxypeptidase A2/CPA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carboxypeptidase A2/CPA2 Antibody - BSA Free and earn rewards!

Have you used Carboxypeptidase A2/CPA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...