Casein Kinase 2 beta Antibody (9T5J10)

Novus Biologicals | Catalog # NBP3-16264

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9T5J10 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (P67870). YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Casein Kinase 2 beta Antibody (9T5J10)

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Casein Kinase 2 beta Antibody (9T5J10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Casein Kinase 2 beta

Casein Kinase 2 beta encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq]

Alternate Names

CK2B, CK2N, CSK2B, CSNK2B, G5A, Phosvitin

Gene Symbol

CSNK2B

Additional Casein Kinase 2 beta Products

Product Documents for Casein Kinase 2 beta Antibody (9T5J10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Casein Kinase 2 beta Antibody (9T5J10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Casein Kinase 2 beta Antibody (9T5J10)

There are currently no reviews for this product. Be the first to review Casein Kinase 2 beta Antibody (9T5J10) and earn rewards!

Have you used Casein Kinase 2 beta Antibody (9T5J10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail