CAT1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90066
Key Product Details
Species Reactivity
Applications
Validated:
Cited:
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Scientific Data Images for CAT1 Antibody - BSA Free
Western Blot: CAT1 Antibody - BSA Free [NBP1-90066]
Analysis in human cell line SCLC-21H.Applications for CAT1 Antibody - BSA Free
Immunohistochemistry-Paraffin
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: CAT1/SLC7A1
Long Name
Alternate Names
Gene Symbol
Additional CAT1/SLC7A1 Products
Product Documents for CAT1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CAT1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CAT1 Antibody - BSA Free
Customer Reviews for CAT1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CAT1 Antibody - BSA Free and earn rewards!
Have you used CAT1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for CAT1 Antibody - BSA Free
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.