CBFA2T3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57636

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CBFA2T3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CBFA2T3 Antibody - BSA Free (NBP2-57636) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CBFA2T3 Antibody - BSA Free

Western Blot: CBFA2T3 Antibody [NBP2-57636]

Western Blot: CBFA2T3 Antibody [NBP2-57636]

Western Blot: CBFA2T3 Antibody [NBP2-57636] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636]

Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636]

Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.

Applications for CBFA2T3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBFA2T3

The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of this gene. In addition, this gene is a putative breast tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene, and a brefeldin A-sensitive association of RII-alpha protein with one of the isoforms has been demonstrated in the Golgi apparatus. [provided by RefSeq]

Alternate Names

core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b

Gene Symbol

CBFA2T3

Additional CBFA2T3 Products

Product Documents for CBFA2T3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CBFA2T3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBFA2T3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBFA2T3 Antibody - BSA Free and earn rewards!

Have you used CBFA2T3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies