CBFB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87300

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CBFB Antibody - BSA Free

Western Blot: CBFB Antibody [NBP1-87300]

Western Blot: CBFB Antibody [NBP1-87300]

Western Blot: CBFB Antibody [NBP1-87300] - Analysis in control (vector only transfected HEK293T lysate) and CBFB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CBFB Antibody [NBP1-87300]

Immunocytochemistry/ Immunofluorescence: CBFB Antibody [NBP1-87300]

Immunocytochemistry/Immunofluorescence: CBFB Antibody [NBP1-87300] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: CBFB Antibody [NBP1-87300]

Immunohistochemistry-Paraffin: CBFB Antibody [NBP1-87300]

Immunohistochemistry-Paraffin: CBFB Antibody [NBP1-87300] - Staining of human colon shows moderate membranous positivity in glandular cells.
CBFB Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: CBFB Antibody - BSA Free [NBP1-87300]

Chromatin Immunoprecipitation-exo-Seq: CBFB Antibody - BSA Free [NBP1-87300]

ChIP-Exo-Seq composite graph for Anti-CBFB (NBP1-87300) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
CBFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CBFB Antibody - BSA Free [NBP1-87300] -

Expression of Cbfb throughout postnatal germline development. (A–D) Analysis of published scRNA-seq data from the postnatal germline development. Uniform manifold approximation projection (UMAP) representation of Cbfb transcripts (A) and germ cell subtypes (B) in the adult (P56) germline. Also, violin plots of Cbfb transcript abundance within germ cell subtypes (C) and spermatogonia through postnatal development (D) are included. (E) Representative images of immunofluorescence staining using an antibody recognizing CBF beta (green) and DAPI (grey) from testis cross-sections of adult wild-type mice. (F–I) Representative images from co-immunofluorescence staining for CBF beta (green) and select spermatogonia markers within the postnatal testis, including LIN28A [(F) undifferentiated spermatogonia], cKIT [(G) differentiating spermatogonia], GFR⍺1 [(H) SSC-enriched spermatogonia], and SOX3 [(I) progenitor-enriched spermatogonia]. White arrowhead identifies CBF beta + cells. Yellow arrowhead identifies CBF beta -cell. Scale bar is 50 um for images in (E–I). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38020932), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CBFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CBFB Antibody - BSA Free [NBP1-87300] -

Expression of Cbfb throughout postnatal germline development. (A–D) Analysis of published scRNA-seq data from the postnatal germline development. Uniform manifold approximation projection (UMAP) representation of Cbfb transcripts (A) and germ cell subtypes (B) in the adult (P56) germline. Also, violin plots of Cbfb transcript abundance within germ cell subtypes (C) and spermatogonia through postnatal development (D) are included. (E) Representative images of immunofluorescence staining using an antibody recognizing CBF beta (green) and DAPI (grey) from testis cross-sections of adult wild-type mice. (F–I) Representative images from co-immunofluorescence staining for CBF beta (green) and select spermatogonia markers within the postnatal testis, including LIN28A [(F) undifferentiated spermatogonia], cKIT [(G) differentiating spermatogonia], GFR⍺1 [(H) SSC-enriched spermatogonia], and SOX3 [(I) progenitor-enriched spermatogonia]. White arrowhead identifies CBF beta + cells. Yellow arrowhead identifies CBF beta -cell. Scale bar is 50 um for images in (E–I). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38020932), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CBFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CBFB Antibody - BSA Free [NBP1-87300] -

Expression of Cbfb throughout postnatal germline development. (A–D) Analysis of published scRNA-seq data from the postnatal germline development. Uniform manifold approximation projection (UMAP) representation of Cbfb transcripts (A) and germ cell subtypes (B) in the adult (P56) germline. Also, violin plots of Cbfb transcript abundance within germ cell subtypes (C) and spermatogonia through postnatal development (D) are included. (E) Representative images of immunofluorescence staining using an antibody recognizing CBF beta (green) and DAPI (grey) from testis cross-sections of adult wild-type mice. (F–I) Representative images from co-immunofluorescence staining for CBF beta (green) and select spermatogonia markers within the postnatal testis, including LIN28A [(F) undifferentiated spermatogonia], cKIT [(G) differentiating spermatogonia], GFR⍺1 [(H) SSC-enriched spermatogonia], and SOX3 [(I) progenitor-enriched spermatogonia]. White arrowhead identifies CBF beta + cells. Yellow arrowhead identifies CBF beta -cell. Scale bar is 50 um for images in (E–I). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38020932), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CBFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CBFB Antibody - BSA Free [NBP1-87300] -

Expression of Cbfb throughout postnatal germline development. (A–D) Analysis of published scRNA-seq data from the postnatal germline development. Uniform manifold approximation projection (UMAP) representation of Cbfb transcripts (A) and germ cell subtypes (B) in the adult (P56) germline. Also, violin plots of Cbfb transcript abundance within germ cell subtypes (C) and spermatogonia through postnatal development (D) are included. (E) Representative images of immunofluorescence staining using an antibody recognizing CBF beta (green) and DAPI (grey) from testis cross-sections of adult wild-type mice. (F–I) Representative images from co-immunofluorescence staining for CBF beta (green) and select spermatogonia markers within the postnatal testis, including LIN28A [(F) undifferentiated spermatogonia], cKIT [(G) differentiating spermatogonia], GFR⍺1 [(H) SSC-enriched spermatogonia], and SOX3 [(I) progenitor-enriched spermatogonia]. White arrowhead identifies CBF beta + cells. Yellow arrowhead identifies CBF beta -cell. Scale bar is 50 um for images in (E–I). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38020932), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CBFB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBFB

The transcription factor Polyomavirus enhancer binding protein 2 (PEBP2), also designated Osf2 (Osteoblast-specific transcription factor), CBFA1 (Core Binding Factor) and AML3 (Acute myeloid leukemia), is composed of two subunits, alpha and beta, which are essential for the regulation of hematopoiesis and osteogenesis. The PEBP2alpha subunits, PEBP2alphaA, PEBP2alphaB and PEBP2alphaC, are encoded by three RUNX genes, all of which contain a 128-amino acid region homologous to the highly conserved Drosophila segmentation gene, runt. This region is involved in DNA binding and heterodimerization with the regulatory beta subunit, which facilitates DNA binding of the alpha subunit. Both subunits are required for in vivo function; the disruption of either gene results in a lack of definitive hematopoiesis followed by embryo death in utero due to hemorrhage in the central nervous system. The gene encoding PEBP2beta is the target of chromosomal inversion 16 (p13;q22) with the smooth muscle myosin heavy chain, producing a chimeric gene, PEBP2beta/CBFbeta-SMMHC, that is associated with human acute myeloid leukemia.

Long Name

Core-binding Factor Subunit beta

Alternate Names

CBF-beta, PEA2-beta, PEBP2B, SL3-3

Gene Symbol

CBFB

Additional CBFB Products

Product Documents for CBFB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CBFB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CBFB Antibody - BSA Free

Customer Reviews for CBFB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBFB Antibody - BSA Free and earn rewards!

Have you used CBFB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...