![Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]](https://resources.rndsystems.com/images/products/CBX3-Antibody-Western-Blot-NBP2-92962-img0011.jpg "Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]")
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human CBX3 (NP_009207.2). MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CBX3 Antibody - BSA Free
Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]
Western Blot: CBX3 Antibody [NBP2-92962] - Western blot analysis of extracts from normal (control) and HP1 gamma/CBX3 knockout (KO) 293T cells, using HP1 gamma/CBX3 antibody (NBP2-92962) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]](https://resources.rndsystems.com/images/products/CBX3-Antibody-Western-Blot-NBP2-92962-img0005.jpg "Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]")
Western Blot: CBX3 AntibodyBSA Free [NBP2-92962]
Western Blot: CBX3 Antibody [NBP2-92962] - Analysis of extracts of various cell lines, using CBX3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.![Immunoprecipitation: CBX3 Antibody - BSA Free [NBP2-92962]](https://resources.rndsystems.com/images/products/CBX3-Antibody-Immunoprecipitation-NBP2-92962-img0006.jpg "Immunoprecipitation: CBX3 Antibody - BSA Free [NBP2-92962]")
Immunoprecipitation: CBX3 Antibody - BSA Free [NBP2-92962]
Immunoprecipitation: CBX3 Antibody [NBP2-92962] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug CBX3 antibody (NBP2-92962). Western blot was performed from the immunoprecipitate using CBX3 antibody (NBP2-92962) at a dilution of 1:1000.![Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]](https://resources.rndsystems.com/images/products/CBX3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92962-img0007.jpg "Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]")
Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]
Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Immunofluorescence analysis of C6 cells using HP1 gamma/CBX3 antibody (NBP2-92962) at dilution of 1:100. Blue: DAPI for nuclear staining.![Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]](https://resources.rndsystems.com/images/products/CBX3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92962-img0001.jpg "Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]")
Immunocytochemistry/ Immunofluorescence: CBX3 Antibody - BSA Free [NBP2-92962]
Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Analysis of U-2 OS cells using CBX3 at dilution of 1:100. Blue: DAPI for nuclear staining.Applications for CBX3 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CBX3
Alternate Names
chromobox homolog 3, chromobox homolog 3 (Drosophila HP1 gamma), chromobox protein homolog 3, Drosophila), HECH, Heterochromatin protein 1 homolog gamma, heterochromatin protein HP1 gamma, heterochromatin-like protein 1, HP1 gamma, HP1 gamma homolog, HP1-GAMMA, Modifier 2 protein
Gene Symbol
CBX3
Additional CBX3 Products
Product Documents for CBX3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CBX3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CBX3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CBX3 Antibody - BSA Free and earn rewards!
Have you used CBX3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...