CBX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10881

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4 (NP_003646). Peptide sequence LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CBX4 Antibody - BSA Free

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP3-10881]

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP3-10881]

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP3-10881] - Immunohistochemical analysis of paraffin-embedded human kidney tissue.

Applications for CBX4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBX4

PC2 is the human homolog of the Drosophila 'Polycomb' (Pc) protein which has been identified as a gene family member associated with a cellular memory system that is responsible for the inheritance of gene activity by progeny cells. The human Pc homolog gene is more closely related to a Xenopus Pc homolog, XPc, than to a previously described human Pc homolog, CBX2 (hPc1). However, the hPc2 and CBX2/hPc1 proteins are shown to colocalize in interphase nuclei of human U-2 OS osteosarcoma cells, suggesting that the proteins are part of a common protein complex. The human protein is believed to function as a repressor of proto-oncogene activity and that interference with hPc2 function can lead to derepression of proto-oncogene transcription and subsequently to cellular transformation. Other reports describe PC2 as a protein that has SUMO E3 activity for the corepressors CtBP and CtBP2.

Alternate Names

chromobox homolog 4, chromobox homolog 4 (Drosophila Pc class), Chromobox protein homolog 4, Drosophila), E3 SUMO-protein ligase CBX4, hPC2, NS5ATP1-binding protein 16, Pc class 2 homolog, Pc2, Polycomb 2 homolog

Gene Symbol

CBX4

Additional CBX4 Products

Product Documents for CBX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CBX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBX4 Antibody - BSA Free and earn rewards!

Have you used CBX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...