CCDC109A Antibody (5G2I5)

Novus Biologicals | Catalog # NBP3-33367

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5G2I5
View all CCDC109A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human CCDC109A (NP_612366.1).

Sequence:
VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CCDC109A Antibody (5G2I5)

CCDC109A Antibody (5G2I5)

Western Blot: CCDC109A Antibody (5G2I5) [NBP3-33367] -

Western Blot: CCDC109A Antibody (5G2I5) [NBP3-33367] - Western blot analysis of various lysates, using [KO Validated] CCDC109A Rabbit mAb at1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
CCDC109A Antibody (5G2I5)

Western Blot: CCDC109A Antibody (5G2I5) [NBP3-33367] -

Western Blot: CCDC109A Antibody (5G2I5) [NBP3-33367] - Western blot analysis of lysates from wild type(WT) and CCDC109A knockout (KO) 293T(KO) cells, using [KO Validated] CCDC109A Rabbit mAb at1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for CCDC109A Antibody (5G2I5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CCDC109A

Long Name

Calcium uniporter protein, mitochondrial

Alternate Names

C10orf42, HsMCU, MCU

Gene Symbol

MCU

Additional CCDC109A Products

Product Documents for CCDC109A Antibody (5G2I5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCDC109A Antibody (5G2I5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCDC109A Antibody (5G2I5)

There are currently no reviews for this product. Be the first to review CCDC109A Antibody (5G2I5) and earn rewards!

Have you used CCDC109A Antibody (5G2I5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies