CCDC44 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88160

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CCDC44 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CCDC44 Antibody [NBP1-88160]

Immunocytochemistry/ Immunofluorescence: CCDC44 Antibody [NBP1-88160]

Immunocytochemistry/Immunofluorescence: CCDC44 Antibody [NBP1-88160] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160] - Staining of human kidney, liver, lymph node and testis using Anti-TACO1 antibody NBP1-88160 (A) shows similar protein distribution across tissues to independent antibody NBP1-88162 (B).
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160] - Staining of human liver.
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160] - Staining of human kidney.
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160] - Staining of human testis.
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160]

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88160] - Staining of human lymph node.
CCDC44 Antibody - BSA Free Western Blot: CCDC44 Antibody - BSA Free [NBP1-88160]

Western Blot: CCDC44 Antibody - BSA Free [NBP1-88160]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: CCDC44 Antibody [NBP1-88160]

Western Blot: CCDC44 Antibody [NBP1-88160]

Western Blot: CCDC44 Antibody [NBP1-88160] - Analysis using Anti-TACO1 antibody NBP1-88160 (A) shows similar pattern to independent antibody NBP1-88162 (B).

Applications for CCDC44 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCDC44

TACO1 is a mitochondrial translational activator required for efficient translation of cytochrome c oxidase (COX) subunit I (MTCO1; MIM 516030) (Weraarpachai et al., 2009).[supplied by OMIM]

Alternate Names

CCDC44translational activator of cytochrome c oxidase 1, clone HQ0477 PRO0477p, coiled-coil domain containing 44, Coiled-coil domain-containing protein 44, translational activator of mitochondrially encoded cytochrome c oxidase I, Translational activator of mitochondrially-encoded cytochrome c oxidase I

Gene Symbol

TACO1

Additional CCDC44 Products

Product Documents for CCDC44 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCDC44 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCDC44 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCDC44 Antibody - BSA Free and earn rewards!

Have you used CCDC44 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...