CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

Novus Biologicals | Catalog # H00006358-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 1F12

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Specificity

CCL14 - chemokine (C-C motif) ligand 14

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

Western Blot: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01]

Western Blot: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01]

Western Blot: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.Lane 1: CCL14 transfected lysate(10.7 KDa).Lane 2: Non-transfected lysate.
ELISA: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01]

ELISA: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01]

ELISA: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.

Applications for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CCL14/HCC-1/HCC-3

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.

Alternate Names

C-C motif chemokine 14, chemokine (C-C motif) ligand 14, Chemokine CC-1/CC-3, chemokine CC-3, CKB1, FLJ16015, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, hemofiltrate CC chemokine 1, MCIF, member 14, NCC2CC-1, NCC-2CKb1, new CC chemokine 2, SCYA14CC-3, Small-inducible cytokine A14

Entrez Gene IDs

6358 (Human)

Gene Symbol

CCL14

OMIM

601392 (Human)

Additional CCL14/HCC-1/HCC-3 Products

Product Documents for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free and earn rewards!

Have you used CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies